(data stored in ACNUC29543 zone)

EMBL: CP001044.PE569

CP001044.PE569       Location/Qualifiers
FT   CDS             654061..654414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3703"
FT                   /product="AIG2 family protein"
FT                   /note="PFAM: AIG2 family protein; KEGG: pfl:PFL_5193
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3703"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72838"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMP4"
FT                   /protein_id="ACC72838.1"
FT                   /translation="MNTPDTPIVHLFSYGTLQDRNVQISSFGRELAGHADALPGYALTL
FT                   LAIADPKVVEISGKTHHPVVRPSGNPADEVAGTVFEITPEELTAADEYEVADYKRVLVT
FT                   LKSGIDAWVYIAA"
     MNTPDTPIVH LFSYGTLQDR NVQISSFGRE LAGHADALPG YALTLLAIAD PKVVEISGKT        60
     HHPVVRPSGN PADEVAGTVF EITPEELTAA DEYEVADYKR VLVTLKSGID AWVYIAA          117
//

If you have problems or comments...

PBIL Back to PBIL home page