(data stored in ACNUC29543 zone)

EMBL: CP001044.PE574

CP001044.PE574       Location/Qualifiers
FT   CDS             658384..658821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3708"
FT                   /product="DGPFAETKE family protein"
FT                   /note="PFAM: DGPFAETKE family protein; KEGG: reu:Reut_B3488
FT                   DGPFAETKE"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3708"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72843"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMP9"
FT                   /protein_id="ACC72843.1"
FT                   /translation="MRVMVIVKATTDSEADKMPSTELLAAMGQFNEELVKAGIMQAGEG
FT                   LHPSSRGKRVRFSGAKRTVIDGPFAETKELIAGFWLWKVKSMDEAVEWVRRCPNPMEGD
FT                   SEIEIRQIFEAEDFGDEFTPELREQEERLRAEIEQQAGKAK"
     MRVMVIVKAT TDSEADKMPS TELLAAMGQF NEELVKAGIM QAGEGLHPSS RGKRVRFSGA        60
     KRTVIDGPFA ETKELIAGFW LWKVKSMDEA VEWVRRCPNP MEGDSEIEIR QIFEAEDFGD       120
     EFTPELREQE ERLRAEIEQQ AGKAK                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page