(data stored in ACNUC29543 zone)

EMBL: CP001044.PE576

CP001044.PE576       Location/Qualifiers
FT   CDS             complement(660019..661173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3710"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   rme:Rmet_1793 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3710"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72845"
FT                   /db_xref="GOA:B2JMQ1"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMQ1"
FT                   /protein_id="ACC72845.1"
FT                   /translation="MYLLKLIARNALRHKLRTTLTVLGLTIAVLAFGLLHTVVDAWYAG
FT                   AAAASNARLVTRNAISLTFPLPLSYEARIRGVEGVTMVARSSWFGGIYREPKNFFAQFA
FT                   VSDNYLDLYPEFLLPAQQRSDYERDRKGCLIGRQLATAYGFKVGDVIPIKGTIYPGTWE
FT                   FVVRGILDGRDESTITRQMIFHWDYLNESVRKMPGRKADQVGVYVVGIDNPDNAAEISR
FT                   RVDSVFKNSLAETLTETEQAFQLGFVAMSNQIIAAIQLVSYVVIVIIMAVMANAMAMSA
FT                   RERTVEYATLKALGFGPGFLALLMFGESLTICTVGAGLGMLATPPAAAFFKQVTGGVFP
FT                   VFAVSRDTMLQQAACALVVGVAAAVVPALQAARVRIVEGLRAIG"
     MYLLKLIARN ALRHKLRTTL TVLGLTIAVL AFGLLHTVVD AWYAGAAAAS NARLVTRNAI        60
     SLTFPLPLSY EARIRGVEGV TMVARSSWFG GIYREPKNFF AQFAVSDNYL DLYPEFLLPA       120
     QQRSDYERDR KGCLIGRQLA TAYGFKVGDV IPIKGTIYPG TWEFVVRGIL DGRDESTITR       180
     QMIFHWDYLN ESVRKMPGRK ADQVGVYVVG IDNPDNAAEI SRRVDSVFKN SLAETLTETE       240
     QAFQLGFVAM SNQIIAAIQL VSYVVIVIIM AVMANAMAMS ARERTVEYAT LKALGFGPGF       300
     LALLMFGESL TICTVGAGLG MLATPPAAAF FKQVTGGVFP VFAVSRDTML QQAACALVVG       360
     VAAAVVPALQ AARVRIVEGL RAIG                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page