(data stored in ACNUC29543 zone)

EMBL: CP001044.PE58

CP001044.PE58        Location/Qualifiers
FT   CDS             complement(66565..67251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3159"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bxe:Bxe_B1661 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3159"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72327"
FT                   /db_xref="GOA:B2JRK0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRK0"
FT                   /protein_id="ACC72327.1"
FT                   /translation="MRIAVLEETRAQADFVCRTLSAAGHMCHAFEDGQALVRQLRSQPF
FT                   DLLVLDRHPPGQSGDEVLRWVRQDLAERLPVLFMTRATDVAHQDVDADDHLVKPVSAAA
FT                   LLARVGVLLRGAFQRQQMAEKEVFGEYEFEPGSKRVHVRGSAVTLTHKEFELALLLFKH
FT                   LSRPLSRSHILDAIWKQAAGIPSRTMDTHVSMLRSKLGLRPENGYRLMPIYGYGYRLDR
FT                   IEKGDA"
     MRIAVLEETR AQADFVCRTL SAAGHMCHAF EDGQALVRQL RSQPFDLLVL DRHPPGQSGD        60
     EVLRWVRQDL AERLPVLFMT RATDVAHQDV DADDHLVKPV SAAALLARVG VLLRGAFQRQ       120
     QMAEKEVFGE YEFEPGSKRV HVRGSAVTLT HKEFELALLL FKHLSRPLSR SHILDAIWKQ       180
     AAGIPSRTMD THVSMLRSKL GLRPENGYRL MPIYGYGYRL DRIEKGDA                    228
//

If you have problems or comments...

PBIL Back to PBIL home page