(data stored in ACNUC29543 zone)

EMBL: CP001044.PE586

CP001044.PE586       Location/Qualifiers
FT   CDS             670713..672212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3720"
FT                   /product="putative Chase2 sensor protein"
FT                   /note="PFAM: CHASE2 domain protein; KEGG: dar:Daro_1993
FT                   CHASE2:stage II sporulation E"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3720"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72855"
FT                   /db_xref="GOA:B2JMR1"
FT                   /db_xref="InterPro:IPR007890"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMR1"
FT                   /protein_id="ACC72855.1"
FT                   /translation="MKRLSAPWVTFFRKLLKAGQGRPVALAVLFGLSLLNLYSEWPGGI
FT                   ARPAVFDRFEDFIPDSFNSARQLLFDHYQRRFPRVPASQPVIIVAIDDKTLAAVGQWPW
FT                   PRNRLASLVDAIAAQKPLAIGLDVYMPEADQTSPDKVADNLPDSAATLAAGLRALPSHE
FT                   TILAAALRAAPSVLGAAAVDHAALDTSTDLHSAPILVHGVDPLNHVKRYGYVLASLPEL
FT                   QAAAHGQGMLNVALEQGAVRRIPLILGLGDKLVPCMPIEMLRVVTRSAAVDVYADAAGV
FT                   QSVGVADVQVPTQPDGDIWLHFASMRSTQHRYVSAGDVLQGQVDPERFRDKLVLVGLTG
FT                   TGLTDMRTTALGELVPGIEIQAQIIETIFEGRFLRRPVWVKWVETLFVLGFGLLIIWYL
FT                   PHTDSKLAAFVRAVPKGTAIIGVVLNLLLLATCLLLFKLFGLLVDAASIFIILSAVMGC
FT                   FFSTALLDSAQTLRDALLSRPTKANAPEKTAAAQPVRHPES"
     MKRLSAPWVT FFRKLLKAGQ GRPVALAVLF GLSLLNLYSE WPGGIARPAV FDRFEDFIPD        60
     SFNSARQLLF DHYQRRFPRV PASQPVIIVA IDDKTLAAVG QWPWPRNRLA SLVDAIAAQK       120
     PLAIGLDVYM PEADQTSPDK VADNLPDSAA TLAAGLRALP SHETILAAAL RAAPSVLGAA       180
     AVDHAALDTS TDLHSAPILV HGVDPLNHVK RYGYVLASLP ELQAAAHGQG MLNVALEQGA       240
     VRRIPLILGL GDKLVPCMPI EMLRVVTRSA AVDVYADAAG VQSVGVADVQ VPTQPDGDIW       300
     LHFASMRSTQ HRYVSAGDVL QGQVDPERFR DKLVLVGLTG TGLTDMRTTA LGELVPGIEI       360
     QAQIIETIFE GRFLRRPVWV KWVETLFVLG FGLLIIWYLP HTDSKLAAFV RAVPKGTAII       420
     GVVLNLLLLA TCLLLFKLFG LLVDAASIFI ILSAVMGCFF STALLDSAQT LRDALLSRPT       480
     KANAPEKTAA AQPVRHPES                                                    499
//

If you have problems or comments...

PBIL Back to PBIL home page