(data stored in ACNUC29543 zone)

EMBL: CP001044.PE587

CP001044.PE587       Location/Qualifiers
FT   CDS             complement(672262..672543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3721"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A2488 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3721"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72856"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMR2"
FT                   /protein_id="ACC72856.1"
FT                   /translation="MKSKIIVAVLVASAASLAAPAFASGYGPAPYYRPDVGAPASQAGQ
FT                   TAQTLAAEAMQASAADESRASVGGDETMTTQSGRRAPAVRLDEVYSGS"
     MKSKIIVAVL VASAASLAAP AFASGYGPAP YYRPDVGAPA SQAGQTAQTL AAEAMQASAA        60
     DESRASVGGD ETMTTQSGRR APAVRLDEVY SGS                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page