(data stored in ACNUC29543 zone)

EMBL: CP001044.PE588

CP001044.PE588       Location/Qualifiers
FT   CDS             complement(673009..674172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3722"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nca:Noca_2218 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3722"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72857"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMR3"
FT                   /protein_id="ACC72857.1"
FT                   /translation="MSYGIVSRVVTFGAILMLASCGGGGGGSGSSPGSPSASNSQPTLA
FT                   KATALVDGTKVGDDYWAAGSTQSGGTGQTVSGLNCGARGNVYTYSHLSVYLNGRPLALP
FT                   TNIGTVAPTLAAQTGCAYPVHTDDESGKIRMDASTGASYTLGQFFAIWGQPLTSSNVAG
FT                   LTGMPITIYVNNGGQLSKYTGDPASLVLPPHGEVSIQIGTPLGQIPTFAWTDPPSFDPN
FT                   QTVLAFGGTVGTGHWQDGSTSTGGTGADVDGLVCASGMSETYHVHAHLAIINNGQWLAL
FT                   PQNIGILSQCNYEMHTHDHTGIIHIETPNAKNFTLGQFFDIWGQTLSRTNVAGVTGTVV
FT                   AYINDNGDVRRYEGELRDIPMISHRDITLQIGSPVNSLATYSWYEPQ"
     MSYGIVSRVV TFGAILMLAS CGGGGGGSGS SPGSPSASNS QPTLAKATAL VDGTKVGDDY        60
     WAAGSTQSGG TGQTVSGLNC GARGNVYTYS HLSVYLNGRP LALPTNIGTV APTLAAQTGC       120
     AYPVHTDDES GKIRMDASTG ASYTLGQFFA IWGQPLTSSN VAGLTGMPIT IYVNNGGQLS       180
     KYTGDPASLV LPPHGEVSIQ IGTPLGQIPT FAWTDPPSFD PNQTVLAFGG TVGTGHWQDG       240
     STSTGGTGAD VDGLVCASGM SETYHVHAHL AIINNGQWLA LPQNIGILSQ CNYEMHTHDH       300
     TGIIHIETPN AKNFTLGQFF DIWGQTLSRT NVAGVTGTVV AYINDNGDVR RYEGELRDIP       360
     MISHRDITLQ IGSPVNSLAT YSWYEPQ                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page