(data stored in ACNUC29543 zone)

EMBL: CP001044.PE589

CP001044.PE589       Location/Qualifiers
FT   CDS             complement(674311..674649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3723"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_4501 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3723"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72858"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMR4"
FT                   /protein_id="ACC72858.1"
FT                   /translation="MSEELWCVHIEGPDDFVATSSREAAEREASAINAYLDSAKGRLQE
FT                   RAPTRMVRASAAVWPYTAAGHARSLETDWEDLQRMPHRRTKQETHEGMLSSVLRRMKTL
FT                   ASSARRKS"
     MSEELWCVHI EGPDDFVATS SREAAEREAS AINAYLDSAK GRLQERAPTR MVRASAAVWP        60
     YTAAGHARSL ETDWEDLQRM PHRRTKQETH EGMLSSVLRR MKTLASSARR KS               112
//

If you have problems or comments...

PBIL Back to PBIL home page