(data stored in ACNUC29543 zone)

EMBL: CP001044.PE59

CP001044.PE59        Location/Qualifiers
FT   CDS             complement(68114..69004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3160"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; Helix-turn-helix type
FT                   11 domain protein; KEGG: bxe:Bxe_B1665 transcriptional
FT                   regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3160"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72328"
FT                   /db_xref="GOA:B2JRK1"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRK1"
FT                   /protein_id="ACC72328.1"
FT                   /translation="MGPTRPCGFIWTYIESAQLGLLDWRSFPDPAPMFATHRQNEILRL
FT                   VRARQTCTIAELAATFAVSDETIRRDLKPLVAGGLLVKVHGGVMLPAQLDEPPFRRRMV
FT                   EQREAKRAIAARVAQLIEDGDSLMLDGGTTCVHIAQALESHTRLSVVTNSAEVARLLSP
FT                   RNGNRVLMAGGELRADDASAVGDSALAFFRQFHVRHAIVSVTAIDAKARFMDAHPADAA
FT                   IAQAAFAQAERRIVAADHTKFGHSALVHVFGAQGLDTLVTDIEPATGLSKVLTHAGVEI
FT                   IRASSVADDTSEEVV"
     MGPTRPCGFI WTYIESAQLG LLDWRSFPDP APMFATHRQN EILRLVRARQ TCTIAELAAT        60
     FAVSDETIRR DLKPLVAGGL LVKVHGGVML PAQLDEPPFR RRMVEQREAK RAIAARVAQL       120
     IEDGDSLMLD GGTTCVHIAQ ALESHTRLSV VTNSAEVARL LSPRNGNRVL MAGGELRADD       180
     ASAVGDSALA FFRQFHVRHA IVSVTAIDAK ARFMDAHPAD AAIAQAAFAQ AERRIVAADH       240
     TKFGHSALVH VFGAQGLDTL VTDIEPATGL SKVLTHAGVE IIRASSVADD TSEEVV           296
//

If you have problems or comments...

PBIL Back to PBIL home page