(data stored in ACNUC29543 zone)

EMBL: CP001044.PE591

CP001044.PE591       Location/Qualifiers
FT   CDS             complement(676200..677714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3725"
FT                   /product="mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase"
FT                   /EC_number="2.7.7.22"
FT                   /note="KEGG: bxe:Bxe_B1730
FT                   mannose-1-phosphateguanylyltransferase/mannose-6-phosphate
FT                   isomerase; TIGRFAM: mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase; PFAM:
FT                   mannose-6-phosphate isomerase type II; Nucleotidyl
FT                   transferase; Cupin 2 conserved barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3725"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72860"
FT                   /db_xref="GOA:B2JMR6"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B2JMR6"
FT                   /protein_id="ACC72860.1"
FT                   /translation="MDKRTTHAEQHNAAAAAEAAVESGRLVQVILAGGSGTRLWPVSRE
FT                   QYPKQLIDVVGDQSLLQATMKRMDGFAKTWDVAAQPVIVCGAEHFYVTSEQASDCGVKP
FT                   CVVVEPARRDTAPALTLAALTASSDGDDPILVAMPADHAIADVPALHLAIDVAARHAQA
FT                   GEIATLGVPPTRADTGFGYIRLGAQLQDGAHRIDRFVEKPAAELAAQYVASGGYWWNSG
FT                   MFVVRASVWLAALKIFQPDMYAACVQAYENAKRDDGYIAPGADAFAQSPSDSIDYAVME
FT                   HLGKPESPFTGVVVPLEAGWSDLGSWDAVWEAMEKDEFGNVANGRVLMEGATTTYARSQ
FT                   GGRLVACVGTSDIVVVETDDAVLVADRSHVQDVKGLVSRIRQTNSPEADIHRKVRRPWG
FT                   FYDSIDNGERFQVKRIVVNPGGRLSLQMHHHRAEHWIVVCGTALVTRGEEQFLLTENQS
FT                   TYIPIGVQHRLENPGHVPLQIIEVQSGAYLGEDDIVRFDDKYGRCN"
     MDKRTTHAEQ HNAAAAAEAA VESGRLVQVI LAGGSGTRLW PVSREQYPKQ LIDVVGDQSL        60
     LQATMKRMDG FAKTWDVAAQ PVIVCGAEHF YVTSEQASDC GVKPCVVVEP ARRDTAPALT       120
     LAALTASSDG DDPILVAMPA DHAIADVPAL HLAIDVAARH AQAGEIATLG VPPTRADTGF       180
     GYIRLGAQLQ DGAHRIDRFV EKPAAELAAQ YVASGGYWWN SGMFVVRASV WLAALKIFQP       240
     DMYAACVQAY ENAKRDDGYI APGADAFAQS PSDSIDYAVM EHLGKPESPF TGVVVPLEAG       300
     WSDLGSWDAV WEAMEKDEFG NVANGRVLME GATTTYARSQ GGRLVACVGT SDIVVVETDD       360
     AVLVADRSHV QDVKGLVSRI RQTNSPEADI HRKVRRPWGF YDSIDNGERF QVKRIVVNPG       420
     GRLSLQMHHH RAEHWIVVCG TALVTRGEEQ FLLTENQSTY IPIGVQHRLE NPGHVPLQII       480
     EVQSGAYLGE DDIVRFDDKY GRCN                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page