(data stored in ACNUC29543 zone)

EMBL: CP001044.PE598

CP001044.PE598       Location/Qualifiers
FT   CDS             complement(685623..686738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3732"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   bxe:Bxe_A3712 putative glycosyl transferases group 1
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3732"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72867"
FT                   /db_xref="GOA:B2JN19"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:B2JN19"
FT                   /protein_id="ACC72867.1"
FT                   /translation="MAFAINGKFTSQPITGVQRVAYELTRAMQMRESPGSELEIFVPQN
FT                   AREPGASLKRQRRFPWLRGTLWEQITLPIAARGRTLVNLCNTNPVLKRRQVVMVHDMAV
FT                   YDMPHGFSKKFLLWYRLCFSILPRMEPLVLTVSAFSKRRISHHLKIDESRIAVIQPGAD
FT                   HLDRVVPESGVLERLQLKEDTYCVIVGSLDPRKNLQRVLEAISGLSHLRDVKFVIVGGR
FT                   NQRIFANEGLETMSRSKQVIWAGFVSDGELKALYQHAGCLVFPSLYEGFGLPPLEAMYC
FT                   GCPVIASSRTSIPEACGDAAMYCDAMSVADMAEKISLMMTHSAIRQQYRAKGMAHAREY
FT                   RWDRSAKRLLDLLYGKESEPVSEMSARVSAG"
     MAFAINGKFT SQPITGVQRV AYELTRAMQM RESPGSELEI FVPQNAREPG ASLKRQRRFP        60
     WLRGTLWEQI TLPIAARGRT LVNLCNTNPV LKRRQVVMVH DMAVYDMPHG FSKKFLLWYR       120
     LCFSILPRME PLVLTVSAFS KRRISHHLKI DESRIAVIQP GADHLDRVVP ESGVLERLQL       180
     KEDTYCVIVG SLDPRKNLQR VLEAISGLSH LRDVKFVIVG GRNQRIFANE GLETMSRSKQ       240
     VIWAGFVSDG ELKALYQHAG CLVFPSLYEG FGLPPLEAMY CGCPVIASSR TSIPEACGDA       300
     AMYCDAMSVA DMAEKISLMM THSAIRQQYR AKGMAHAREY RWDRSAKRLL DLLYGKESEP       360
     VSEMSARVSA G                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page