(data stored in ACNUC29543 zone)

EMBL: CP001044.PE60

CP001044.PE60        Location/Qualifiers
FT   CDS             69118..71601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3161"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; glycine cleavage
FT                   T protein (aminomethyl transferase); Glycine cleavage
FT                   T-protein barrel; KEGG: bxe:Bxe_B1666 dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3161"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72329"
FT                   /db_xref="GOA:B2JRK2"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR032503"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRK2"
FT                   /protein_id="ACC72329.1"
FT                   /translation="MSTPLPTQARVVIVGGGIIGCSVAYHLTKLGWTDVVLLEQGQLSC
FT                   GTTWHAAGLVGQLRAQESMTKLIRYSTALYAELEADTGLATGWKQCGSLSVARTAQRMT
FT                   QLRRTAAIARAYGVACDVIGPQEAGELWQPMRTDDLLGAVWLPGDGKANPTDLTQALAR
FT                   GARRRGARIVENTRVTAIHTRAAAKGRAASGVAWRDKQGDEGAIAAEIVVNCAGQWAKQ
FT                   VGRLCGVTVPLHSAEHYYIVTERIEGVHPDLPVMRDPDGYIYFKEEVGGLVMGGFEPDA
FT                   KPWGMNGIPDHFEFQLLPDDWDQFQILMENALQRVPALETAQVRQFYNGPESFTPDNNF
FT                   MLGEAPELRNFYVGAGFNSMGIASAGGAGMALAEWIVAGEPTMDLWPVDIRRFARFNGN
FT                   DTWLHDRVKETLGLHYAMPWPNREPDSARPFRRSPLYALLRDDGACFGSKMGWERANFF
FT                   APTGEQAHIDYSFGQQNWLSWSGEEHRACREGAALFDLTPFSKFLVKGRDAEAVLQQIV
FT                   ANDVAVPPGTSVYTGMLNERGGYESDFTLTRLCDDQYLLVTGSAQTTRDFDAIERRIPP
FT                   DSHCMLVDVTSQYAVLAVMGPRARDLLASVSKAGWNNEAFAFGQSREVDIGYATVRATR
FT                   ITYVGELGWELYVPVEFAVGVYETLHAAGKQFGLKNAGYYALDSLRIEKGYRAWGRELS
FT                   PETNPFEAGLAFACKLDKDVPFVGREALVRLRGEPLQRRLAVLTADGASDRMLWGGEAI
FT                   VRDGVAVGFVSSAAFGHTLGCPVAMGYVKRNDGAALDDAWLTSGRYQIDVAGELLHATL
FT                   HLRAPYDPAATRVKS"
     MSTPLPTQAR VVIVGGGIIG CSVAYHLTKL GWTDVVLLEQ GQLSCGTTWH AAGLVGQLRA        60
     QESMTKLIRY STALYAELEA DTGLATGWKQ CGSLSVARTA QRMTQLRRTA AIARAYGVAC       120
     DVIGPQEAGE LWQPMRTDDL LGAVWLPGDG KANPTDLTQA LARGARRRGA RIVENTRVTA       180
     IHTRAAAKGR AASGVAWRDK QGDEGAIAAE IVVNCAGQWA KQVGRLCGVT VPLHSAEHYY       240
     IVTERIEGVH PDLPVMRDPD GYIYFKEEVG GLVMGGFEPD AKPWGMNGIP DHFEFQLLPD       300
     DWDQFQILME NALQRVPALE TAQVRQFYNG PESFTPDNNF MLGEAPELRN FYVGAGFNSM       360
     GIASAGGAGM ALAEWIVAGE PTMDLWPVDI RRFARFNGND TWLHDRVKET LGLHYAMPWP       420
     NREPDSARPF RRSPLYALLR DDGACFGSKM GWERANFFAP TGEQAHIDYS FGQQNWLSWS       480
     GEEHRACREG AALFDLTPFS KFLVKGRDAE AVLQQIVAND VAVPPGTSVY TGMLNERGGY       540
     ESDFTLTRLC DDQYLLVTGS AQTTRDFDAI ERRIPPDSHC MLVDVTSQYA VLAVMGPRAR       600
     DLLASVSKAG WNNEAFAFGQ SREVDIGYAT VRATRITYVG ELGWELYVPV EFAVGVYETL       660
     HAAGKQFGLK NAGYYALDSL RIEKGYRAWG RELSPETNPF EAGLAFACKL DKDVPFVGRE       720
     ALVRLRGEPL QRRLAVLTAD GASDRMLWGG EAIVRDGVAV GFVSSAAFGH TLGCPVAMGY       780
     VKRNDGAALD DAWLTSGRYQ IDVAGELLHA TLHLRAPYDP AATRVKS                     827
//

If you have problems or comments...

PBIL Back to PBIL home page