(data stored in ACNUC29543 zone)

EMBL: CP001044.PE600

CP001044.PE600       Location/Qualifiers
FT   CDS             690084..691121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3734"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: reh:H16_A1853 transcriptional regulator,
FT                   AraC-family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3734"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72869"
FT                   /db_xref="GOA:B2JN21"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2JN21"
FT                   /protein_id="ACC72869.1"
FT                   /translation="MNGIYQSHPLRADERPENSKLRKHIGLLIAPHCSMAAAGAISDAF
FT                   CLANKLEEELGVDAPYRFTVLSEGGGFVTGGASFPIWTQKLDRYQLSDFHAFFVACSGD
FT                   PTTESSEQLVAWLSRQGPGAPACTRQKTDLSSGSVQSAVPVFVLDDGLSATRPAGATPT
FT                   EMALVQIERDVSPDTVRRIAHSLQPHVRQRMRPDADDLSSATTTEKIRESARWIRENYS
FT                   KTISVSQAADSAAMSKRNYQRRFKVEFGMTPLEYLLRTRFEVVCSMLMDTDLPIDKIAR
FT                   RCGMGDGNRLGRIFKVRYGMSPTSFRALRHLGNANHGAPVPPAAANCRALQPTAAASSL
FT                   MKSAY"
     MNGIYQSHPL RADERPENSK LRKHIGLLIA PHCSMAAAGA ISDAFCLANK LEEELGVDAP        60
     YRFTVLSEGG GFVTGGASFP IWTQKLDRYQ LSDFHAFFVA CSGDPTTESS EQLVAWLSRQ       120
     GPGAPACTRQ KTDLSSGSVQ SAVPVFVLDD GLSATRPAGA TPTEMALVQI ERDVSPDTVR       180
     RIAHSLQPHV RQRMRPDADD LSSATTTEKI RESARWIREN YSKTISVSQA ADSAAMSKRN       240
     YQRRFKVEFG MTPLEYLLRT RFEVVCSMLM DTDLPIDKIA RRCGMGDGNR LGRIFKVRYG       300
     MSPTSFRALR HLGNANHGAP VPPAAANCRA LQPTAAASSL MKSAY                       345
//

If you have problems or comments...

PBIL Back to PBIL home page