(data stored in ACNUC29543 zone)

EMBL: CP001044.PE602

CP001044.PE602       Location/Qualifiers
FT   CDS             complement(692231..693781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3736"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A3851 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3736"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72871"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B2JN23"
FT                   /protein_id="ACC72871.1"
FT                   /translation="MNKRRQFLGALTALGGSYILTACGGGGTDISAGAGDAVAKATARA
FT                   STSASGTTIPSATSIIDNAGNTWTLSGGSVYKNGAKAGNTYNVSLVLFMGGVIYHQGSG
FT                   GQFYAWNGSAWNACNDPRLGGTSPDGTTIPSASYIIDKTGAMWTVVGGVIYRNNKTVGN
FT                   TYNVSMLLWYGGKIWHKGTGGQFYVNTDVGGWLPCSDPRIATAATAGMFYGINGHFDYT
FT                   YTPAQLVSILNGMGCKSYRVGCTDDPKQIAAVTKLAQAFQPAGITLLVLINQGVYDSNG
FT                   VVFSSESAAYNRGQQVAMTVANALKPYGVTIYECGNELTRQNATVLDFTNAGTKAVDFN
FT                   NANWPAMRGAMRGMIDGVKAVQPSAKCGINFCVADIGAADALWDGMQPDGSGGHPKVRW
FT                   DITTWHNYEVYGDIFNIGIDGAGPGFDLPTYCKARYGVPFIITEWNTGPEKTQTYRASY
FT                   ITSTLGKYYQARKSHNIQAVMYYVLDSGNNTYGVMTNGTALNPPYSAFTSFVSGNADI"
     MNKRRQFLGA LTALGGSYIL TACGGGGTDI SAGAGDAVAK ATARASTSAS GTTIPSATSI        60
     IDNAGNTWTL SGGSVYKNGA KAGNTYNVSL VLFMGGVIYH QGSGGQFYAW NGSAWNACND       120
     PRLGGTSPDG TTIPSASYII DKTGAMWTVV GGVIYRNNKT VGNTYNVSML LWYGGKIWHK       180
     GTGGQFYVNT DVGGWLPCSD PRIATAATAG MFYGINGHFD YTYTPAQLVS ILNGMGCKSY       240
     RVGCTDDPKQ IAAVTKLAQA FQPAGITLLV LINQGVYDSN GVVFSSESAA YNRGQQVAMT       300
     VANALKPYGV TIYECGNELT RQNATVLDFT NAGTKAVDFN NANWPAMRGA MRGMIDGVKA       360
     VQPSAKCGIN FCVADIGAAD ALWDGMQPDG SGGHPKVRWD ITTWHNYEVY GDIFNIGIDG       420
     AGPGFDLPTY CKARYGVPFI ITEWNTGPEK TQTYRASYIT STLGKYYQAR KSHNIQAVMY       480
     YVLDSGNNTY GVMTNGTALN PPYSAFTSFV SGNADI                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page