(data stored in ACNUC29543 zone)

EMBL: CP001044.PE604

CP001044.PE604       Location/Qualifiers
FT   CDS             complement(695762..697171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3738"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: bxe:Bxe_B1263 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3738"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72873"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B2JN25"
FT                   /protein_id="ACC72873.1"
FT                   /translation="MFDAALLRKSFAPTVRQTTSSSSGMSHRSVGVVPCSLVYIEADSA
FT                   GSPNCTSVDPYCYVEQAITLNRSLKAVGLPALTVATNVAGQVMHYLEKVDADARPHVVQ
FT                   LSPSALTLPKITRFYSAHFKLDMMEQLGATLHEGELLMVLDTDMLALRPVDEELLLRCQ
FT                   TIGVGAFDISDQEFSAYGDARVIGDLETVAGARLQNPRWFGGEILLASAGFIAALVPRA
FT                   HACFERYTHAIHELNHNGDEAFISAALNLLADEGVPIIDLGAHRVVGRHWSGNTHRDLR
FT                   WFKGCSLLHLPGCKRLLERQARRQGFSAAHVWRSVVVRHEINRTVWPLRRWVRAQVRHR
FT                   MRRGAAQPAARVDVLVLDPDAGRLSQLVSRLTSHGVYVMSALSTEEARNEARRLNPRVI
FT                   VSSSPLGAVDARDLLDTVDARHRPVMIALSTDDARLDWAHWDTWFPGSADPSDVVQAVK
FT                   QALGSRQPHAS"
     MFDAALLRKS FAPTVRQTTS SSSGMSHRSV GVVPCSLVYI EADSAGSPNC TSVDPYCYVE        60
     QAITLNRSLK AVGLPALTVA TNVAGQVMHY LEKVDADARP HVVQLSPSAL TLPKITRFYS       120
     AHFKLDMMEQ LGATLHEGEL LMVLDTDMLA LRPVDEELLL RCQTIGVGAF DISDQEFSAY       180
     GDARVIGDLE TVAGARLQNP RWFGGEILLA SAGFIAALVP RAHACFERYT HAIHELNHNG       240
     DEAFISAALN LLADEGVPII DLGAHRVVGR HWSGNTHRDL RWFKGCSLLH LPGCKRLLER       300
     QARRQGFSAA HVWRSVVVRH EINRTVWPLR RWVRAQVRHR MRRGAAQPAA RVDVLVLDPD       360
     AGRLSQLVSR LTSHGVYVMS ALSTEEARNE ARRLNPRVIV SSSPLGAVDA RDLLDTVDAR       420
     HRPVMIALST DDARLDWAHW DTWFPGSADP SDVVQAVKQA LGSRQPHAS                   469
//

If you have problems or comments...

PBIL Back to PBIL home page