(data stored in ACNUC29543 zone)

EMBL: CP001044.PE605

CP001044.PE605       Location/Qualifiers
FT   CDS             complement(697445..699232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3739"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A3851 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3739"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72874"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B2JN26"
FT                   /protein_id="ACC72874.1"
FT                   /translation="MRFAVALAAHPYRFVHRVHSRAVDSFFMVKRREFLGMVTAVGGSY
FT                   VLTACGGGGGGSRTGQGNTSSASATGTSAASGTTAATTNTSTTQNGRTSSAVNGTSPTS
FT                   NGTTSGSSTDPNAGSNSGTVGSPNGTEVPPAASITDNQGALWTLAQGSVYRNGVAAGNT
FT                   YNVTLLLWYGNGIYHQGTGGQFYGWNGTTWLACNDPRLGGTSADGTTVPSASYIIDKMG
FT                   ALWTVSTNGMVLRNNAYAGATSNVSLLLWYGGKLWYRSTSGQFYVCTDLDQWLPCSDPR
FT                   IAVAATRGSFHGINGHYDYRYTAAQIVQIMQNMGCSTYRVGCTDDPVQLGAVTRLAQAF
FT                   QAAGLTLFVLVNLGVRDANGALFANESAAYTRGRACGANVAAALSQYGVVMYECGNELT
FT                   RDSAIILDSTNAGTKVADFSNANWPVMRGVMRGMIDGVKSAQANAKCGINFCVADIGAA
FT                   DALWDGKQPDGTSGHPAVRWDLTTWHNYEVYGDIFDIGTDGAGPGFDLPTYCKARYGAP
FT                   FLLTEWNTGPEKSQSYRANYISARYATYYQARTTKNIQSVMYYELDSGDATYGVMIDGV
FT                   TLNLPYNALVSFVASHPDS"
     MRFAVALAAH PYRFVHRVHS RAVDSFFMVK RREFLGMVTA VGGSYVLTAC GGGGGGSRTG        60
     QGNTSSASAT GTSAASGTTA ATTNTSTTQN GRTSSAVNGT SPTSNGTTSG SSTDPNAGSN       120
     SGTVGSPNGT EVPPAASITD NQGALWTLAQ GSVYRNGVAA GNTYNVTLLL WYGNGIYHQG       180
     TGGQFYGWNG TTWLACNDPR LGGTSADGTT VPSASYIIDK MGALWTVSTN GMVLRNNAYA       240
     GATSNVSLLL WYGGKLWYRS TSGQFYVCTD LDQWLPCSDP RIAVAATRGS FHGINGHYDY       300
     RYTAAQIVQI MQNMGCSTYR VGCTDDPVQL GAVTRLAQAF QAAGLTLFVL VNLGVRDANG       360
     ALFANESAAY TRGRACGANV AAALSQYGVV MYECGNELTR DSAIILDSTN AGTKVADFSN       420
     ANWPVMRGVM RGMIDGVKSA QANAKCGINF CVADIGAADA LWDGKQPDGT SGHPAVRWDL       480
     TTWHNYEVYG DIFDIGTDGA GPGFDLPTYC KARYGAPFLL TEWNTGPEKS QSYRANYISA       540
     RYATYYQART TKNIQSVMYY ELDSGDATYG VMIDGVTLNL PYNALVSFVA SHPDS            595
//

If you have problems or comments...

PBIL Back to PBIL home page