(data stored in ACNUC29543 zone)

EMBL: CP001044.PE608

CP001044.PE608       Location/Qualifiers
FT   CDS             702300..702578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3742"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1529 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3742"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72877"
FT                   /db_xref="UniProtKB/TrEMBL:B2JN29"
FT                   /protein_id="ACC72877.1"
FT                   /translation="MLNWLANLISHHAPTPEKQAERALSELRMGLFQAEQRVLDAQLQA
FT                   DYYRSRIAFCEQVAKGGIEQVSDRRRSPPQEAAVDTLRPSLKLTAAQ"
     MLNWLANLIS HHAPTPEKQA ERALSELRMG LFQAEQRVLD AQLQADYYRS RIAFCEQVAK        60
     GGIEQVSDRR RSPPQEAAVD TLRPSLKLTA AQ                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page