(data stored in ACNUC29543 zone)

EMBL: CP001044.PE61

CP001044.PE61        Location/Qualifiers
FT   CDS             complement(71625..72482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3162"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: bxe:Bxe_B1673 putative transcriptional
FT                   regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3162"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72330"
FT                   /db_xref="GOA:B2JRK3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRK3"
FT                   /protein_id="ACC72330.1"
FT                   /translation="MNANHPAWVPHSGARESLLSSASLGWSGFGAELLGISAGTHCLPA
FT                   FAEHRVGVHVGAPVRAVCRCDGQRAARIQAHGDADVVPAGVDGEWSDDASCTVLRIWFA
FT                   DDFVRTTVDQLGPRSAHAHIRPQLQLRDARVQHLAWAMRAELEAEHACDPLYAESLCTA
FT                   MIVRLAGAAPAGDGKRRTLSSRAAARVIDYIDAHLDGRLTLTELAALVELSVPHFKVLF
FT                   RETMGVPLHRYVVQRRVERARELLLQGRSNASQVALEAGFAHQSHMAHWMKRLLGVTPR
FT                   ELLR"
     MNANHPAWVP HSGARESLLS SASLGWSGFG AELLGISAGT HCLPAFAEHR VGVHVGAPVR        60
     AVCRCDGQRA ARIQAHGDAD VVPAGVDGEW SDDASCTVLR IWFADDFVRT TVDQLGPRSA       120
     HAHIRPQLQL RDARVQHLAW AMRAELEAEH ACDPLYAESL CTAMIVRLAG AAPAGDGKRR       180
     TLSSRAAARV IDYIDAHLDG RLTLTELAAL VELSVPHFKV LFRETMGVPL HRYVVQRRVE       240
     RARELLLQGR SNASQVALEA GFAHQSHMAH WMKRLLGVTP RELLR                       285
//

If you have problems or comments...

PBIL Back to PBIL home page