(data stored in ACNUC29543 zone)

EMBL: CP001044.PE610

CP001044.PE610       Location/Qualifiers
FT   CDS             704510..704758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3745"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A3348 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3745"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72879"
FT                   /db_xref="UniProtKB/TrEMBL:B2JN31"
FT                   /protein_id="ACC72879.1"
FT                   /translation="MKENELDKRFPEDPMWNVAQAIEGCVRAIRTARGKLNPEDCTPGT
FT                   LQYEAVTMDFIDDCIRSLGGDPDAEDDVDDFGIGAAG"
     MKENELDKRF PEDPMWNVAQ AIEGCVRAIR TARGKLNPED CTPGTLQYEA VTMDFIDDCI        60
     RSLGGDPDAE DDVDDFGIGA AG                                                 82
//

If you have problems or comments...

PBIL Back to PBIL home page