(data stored in ACNUC29543 zone)

EMBL: CP001044.PE62

CP001044.PE62        Location/Qualifiers
FT   CDS             72675..73556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3163"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: TrkA-N domain protein; NmrA family protein;
FT                   KEGG: bxe:Bxe_B1674 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3163"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72331"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRK4"
FT                   /protein_id="ACC72331.1"
FT                   /translation="MYVIFGASGNVGRKTAAALRDAGHAVRAVVRNPAHSDMFTGIGCE
FT                   VVQGDLDDEASLHRALHDAHAVQMLCPLPHGGADPAIAMHRMIATAARALRKHPHLHVV
FT                   ALSDYGAEQHEGTGITMLFHDLEAAFAESVRRLTLLRSAEHMHNWARVLPVALATGKLP
FT                   SLHHPLDRPFPTVSAQDVGELAAQLLVEGRDADGVRIVSIEGPRRYDANDVARALSEAA
FT                   RRDITALALPRSEWTPTMLRAGLGANHAKLITDLYDAQNAGCIDVDPRSERRFGKTELP
FT                   GVFAGLVRDARA"
     MYVIFGASGN VGRKTAAALR DAGHAVRAVV RNPAHSDMFT GIGCEVVQGD LDDEASLHRA        60
     LHDAHAVQML CPLPHGGADP AIAMHRMIAT AARALRKHPH LHVVALSDYG AEQHEGTGIT       120
     MLFHDLEAAF AESVRRLTLL RSAEHMHNWA RVLPVALATG KLPSLHHPLD RPFPTVSAQD       180
     VGELAAQLLV EGRDADGVRI VSIEGPRRYD ANDVARALSE AARRDITALA LPRSEWTPTM       240
     LRAGLGANHA KLITDLYDAQ NAGCIDVDPR SERRFGKTEL PGVFAGLVRD ARA              293
//

If you have problems or comments...

PBIL Back to PBIL home page