(data stored in ACNUC29543 zone)

EMBL: CP001044.PE63

CP001044.PE63        Location/Qualifiers
FT   CDS             complement(74700..75017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3165"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   hha:Hhal_0617 transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3165"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72332"
FT                   /db_xref="GOA:B2JRK5"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRK5"
FT                   /protein_id="ACC72332.1"
FT                   /translation="MGKHRTPYPAEFRAHMVELVKSGRTPEELAREFEPTAQTIINWCA
FT                   QADRDAGVRHDGLTTAERQELTRLRRENRQLKMERDILSQAAAWFARETGAVPPKGGTD
FT                   S"
     MGKHRTPYPA EFRAHMVELV KSGRTPEELA REFEPTAQTI INWCAQADRD AGVRHDGLTT        60
     AERQELTRLR RENRQLKMER DILSQAAAWF ARETGAVPPK GGTDS                       105
//

If you have problems or comments...

PBIL Back to PBIL home page