(data stored in ACNUC29543 zone)

EMBL: CP001044.PE64

CP001044.PE64        Location/Qualifiers
FT   CDS             complement(75755..76021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3167"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_6674 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3167"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72333"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRK6"
FT                   /protein_id="ACC72333.1"
FT                   /translation="MEKVVASAGWSLRKMVTDWLAPDPTRGFRISHVGRSGLGRYVCVV
FT                   ADNGAESRAMFFYRHRDGKWCIHPPEPERPAMRVTEFAADRET"
     MEKVVASAGW SLRKMVTDWL APDPTRGFRI SHVGRSGLGR YVCVVADNGA ESRAMFFYRH        60
     RDGKWCIHPP EPERPAMRVT EFAADRET                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page