(data stored in ACNUC29543 zone)

EMBL: CP001044.PE65

CP001044.PE65        Location/Qualifiers
FT   CDS             complement(76349..77254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3168"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="TIGRFAM: transcriptional regulator, ArgP family;
FT                   PFAM: regulatory protein LysR; LysR substrate-binding;
FT                   KEGG: bxe:Bxe_A2670 transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3168"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72334"
FT                   /db_xref="GOA:B2JRK7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017685"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRK7"
FT                   /protein_id="ACC72334.1"
FT                   /translation="MTELETFAAVVEYRSFSQAAAALSISSAAATRRVKRLERSTGALL
FT                   LTREPTVMPTQAGEKVYRHFVSIRLREDDLLRDIEPGRGGTTALALAINADSLATWFEP
FT                   ITRELVQRHVELEVLVDDQDHTLDALARGDVKGFLSTQKKPVGERFAAEPVGQMRYQCV
FT                   ASPEFSSEYFADGLVLPGVLKAPAILFDRKDRLHDVFLGSYFDTTVGRYIKHYLPSPSA
FT                   LLNAIVDGLGYGLVPAMQSEPLITVGSLVALAPDHDVMIDLYWHHWEEEPEPLAKISAL
FT                   VMDAARRSLVQPIPKGDLDG"
     MTELETFAAV VEYRSFSQAA AALSISSAAA TRRVKRLERS TGALLLTREP TVMPTQAGEK        60
     VYRHFVSIRL REDDLLRDIE PGRGGTTALA LAINADSLAT WFEPITRELV QRHVELEVLV       120
     DDQDHTLDAL ARGDVKGFLS TQKKPVGERF AAEPVGQMRY QCVASPEFSS EYFADGLVLP       180
     GVLKAPAILF DRKDRLHDVF LGSYFDTTVG RYIKHYLPSP SALLNAIVDG LGYGLVPAMQ       240
     SEPLITVGSL VALAPDHDVM IDLYWHHWEE EPEPLAKISA LVMDAARRSL VQPIPKGDLD       300
     G                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page