(data stored in ACNUC29543 zone)

EMBL: CP001044.PE7

CP001044.PE7         Location/Qualifiers
FT   CDS             4050..4988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3108"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_B0952 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3108"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72276"
FT                   /db_xref="GOA:B2JR50"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JR50"
FT                   /protein_id="ACC72276.1"
FT                   /translation="MPLRLPPLNSLRFFEAAARLGSFKLAAAELNVTPSAVSHGIVALE
FT                   ETLGVALFVREPRKLSLTPAGELYFPYIAEAFSLILTGTQRLPDGRTHRTISVSCAPTL
FT                   AARWLVPRLHDFRAQWPNLDVSVDTSRRQVGFPVDGFDFGIRLSRGPVPGSDWNRLFGE
FT                   KLVPVCSPACRETLVDAHGEVDLRRATLIHVDTASDDWQTWLDGAGIRNIDATGGLRFD
FT                   TIQLALEAATTGMGVAVGRRPLVNRELDAGMLVKASTLSVDAKTSYWLVCSERADERPE
FT                   LQAFKRWLLHEALAFEALSTHDVTACAAAMR"
     MPLRLPPLNS LRFFEAAARL GSFKLAAAEL NVTPSAVSHG IVALEETLGV ALFVREPRKL        60
     SLTPAGELYF PYIAEAFSLI LTGTQRLPDG RTHRTISVSC APTLAARWLV PRLHDFRAQW       120
     PNLDVSVDTS RRQVGFPVDG FDFGIRLSRG PVPGSDWNRL FGEKLVPVCS PACRETLVDA       180
     HGEVDLRRAT LIHVDTASDD WQTWLDGAGI RNIDATGGLR FDTIQLALEA ATTGMGVAVG       240
     RRPLVNRELD AGMLVKASTL SVDAKTSYWL VCSERADERP ELQAFKRWLL HEALAFEALS       300
     THDVTACAAA MR                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page