(data stored in ACNUC29543 zone)

EMBL: CP001044.PE70

CP001044.PE70        Location/Qualifiers
FT   CDS             84670..85584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3176"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: mmw:Mmwyl1_3825 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3176"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72339"
FT                   /db_xref="GOA:B2JRL2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRL2"
FT                   /protein_id="ACC72339.1"
FT                   /translation="MINNVGLKYFIGVARSGSIRRAAEQLHVAASAISRQIQMLEEELN
FT                   AELFERHRGQKSLRLTAAGELLLNYTRLIENELDQVRADIRAIDTLQKGTVRLGASESF
FT                   SREFLPSFLHRFHSQYPGITFNVIVGGGGKLVELLAKDEIDVALAYRAPDAFDVQVIAE
FT                   THVTPCLLVSATHPFANRRSVDIEECGEIEIALPDESLTIRESYVRMFSKARIRPRTIL
FT                   VTNSFELMRAAAVSGLCNAIVNKYFGNYKVPRGLRYVPLHGEGVERWPLRLCVHTGRSL
FT                   PVSVKLFIEQLQAEMDAVDESRQ"
     MINNVGLKYF IGVARSGSIR RAAEQLHVAA SAISRQIQML EEELNAELFE RHRGQKSLRL        60
     TAAGELLLNY TRLIENELDQ VRADIRAIDT LQKGTVRLGA SESFSREFLP SFLHRFHSQY       120
     PGITFNVIVG GGGKLVELLA KDEIDVALAY RAPDAFDVQV IAETHVTPCL LVSATHPFAN       180
     RRSVDIEECG EIEIALPDES LTIRESYVRM FSKARIRPRT ILVTNSFELM RAAAVSGLCN       240
     AIVNKYFGNY KVPRGLRYVP LHGEGVERWP LRLCVHTGRS LPVSVKLFIE QLQAEMDAVD       300
     ESRQ                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page