(data stored in ACNUC29543 zone)

EMBL: CP001044.PE75

CP001044.PE75        Location/Qualifiers
FT   CDS             92112..92525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3182"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: abu:Abu_0882 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3182"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72344"
FT                   /db_xref="InterPro:IPR025540"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRL7"
FT                   /protein_id="ACC72344.1"
FT                   /translation="MTTLEKGFTTSLTVTVTEEHLASRLDIDAGERFPNVLSTPWLIAH
FT                   LERAAAKALHPLLQDGQLSVGSRVVFDHFAPTPLGATFTAYAKFTGMEGPLYLFDLWAA
FT                   DAGGAIGKGTHARAVVPGVAVEKRAAKRLGQTA"
     MTTLEKGFTT SLTVTVTEEH LASRLDIDAG ERFPNVLSTP WLIAHLERAA AKALHPLLQD        60
     GQLSVGSRVV FDHFAPTPLG ATFTAYAKFT GMEGPLYLFD LWAADAGGAI GKGTHARAVV       120
     PGVAVEKRAA KRLGQTA                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page