(data stored in ACNUC29543 zone)

EMBL: CP001044.PE76

CP001044.PE76        Location/Qualifiers
FT   CDS             92538..93308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3183"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: pol:Bpro_0427 class II aldolase/adducin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3183"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72345"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRL8"
FT                   /protein_id="ACC72345.1"
FT                   /translation="MAASVSQQVGEERATRDDLAAAYRLIAFLGMDDGIYTHISARVPG
FT                   ADENFLINPFGLLFREVTASSLVKIDLEGKLLEPSDYEVNPAGFTIHSAIHAARPDALC
FT                   VMHTHTIGGVAVSSLEDGLQPTNQWAFQFYDRVAYHEYEGLALDLDERARLVASLGPDK
FT                   RCLILRNHGLLTIGRSVAEAFILMHNLERACRVQLAIQSSGQKVRGVPAEVCERTARQY
FT                   ERGGSSASQLDGIAREWKSFRRLLEAQIGSGYRQ"
     MAASVSQQVG EERATRDDLA AAYRLIAFLG MDDGIYTHIS ARVPGADENF LINPFGLLFR        60
     EVTASSLVKI DLEGKLLEPS DYEVNPAGFT IHSAIHAARP DALCVMHTHT IGGVAVSSLE       120
     DGLQPTNQWA FQFYDRVAYH EYEGLALDLD ERARLVASLG PDKRCLILRN HGLLTIGRSV       180
     AEAFILMHNL ERACRVQLAI QSSGQKVRGV PAEVCERTAR QYERGGSSAS QLDGIAREWK       240
     SFRRLLEAQI GSGYRQ                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page