(data stored in ACNUC29543 zone)

EMBL: CP001044.PE79

CP001044.PE79        Location/Qualifiers
FT   CDS             complement(95489..96628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3186"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG:
FT                   bur:Bcep18194_B3151 outer membrane protein (porin)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3186"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72348"
FT                   /db_xref="GOA:B2JRM1"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRM1"
FT                   /protein_id="ACC72348.1"
FT                   /translation="MKRVPLKKRIAVASAVASLAAAIPQLAQAQSSVTLYGLISTGILY
FT                   TSNSGGKSVVSMASGPEQLPRMGLKGREELGGGTAAIFTLENGFNSVNGSLGQGGRMFG
FT                   RWAYVGLTNNTYGTVTVGRQLEEMAQQLYWSESGVIFAAFGTRIGDNDNIFNSNRFNNS
FT                   IRYASPNIHGLTFAGSYAFSNQVGGFSNNNGYSFGANYVSGSLKLGAAFTQFNHPAVAS
FT                   NLNGAVDDGSWGFSNPFVKSLGGAVTAQQRIMGVGASYNFNIVQVAAGYTNVLYNYLDN
FT                   TGLRLQNAELTVTKQITPTTLIGAGYIFTAGNYSADRQPRYHQVNLGSVYSLSKRTDLW
FT                   LVGMYMHAAGDAHHAQIYTTTASSTQNQMAVVTGIRTRF"
     MKRVPLKKRI AVASAVASLA AAIPQLAQAQ SSVTLYGLIS TGILYTSNSG GKSVVSMASG        60
     PEQLPRMGLK GREELGGGTA AIFTLENGFN SVNGSLGQGG RMFGRWAYVG LTNNTYGTVT       120
     VGRQLEEMAQ QLYWSESGVI FAAFGTRIGD NDNIFNSNRF NNSIRYASPN IHGLTFAGSY       180
     AFSNQVGGFS NNNGYSFGAN YVSGSLKLGA AFTQFNHPAV ASNLNGAVDD GSWGFSNPFV       240
     KSLGGAVTAQ QRIMGVGASY NFNIVQVAAG YTNVLYNYLD NTGLRLQNAE LTVTKQITPT       300
     TLIGAGYIFT AGNYSADRQP RYHQVNLGSV YSLSKRTDLW LVGMYMHAAG DAHHAQIYTT       360
     TASSTQNQMA VVTGIRTRF                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page