(data stored in ACNUC29543 zone)

EMBL: CP001044.PE82

CP001044.PE82        Location/Qualifiers
FT   CDS             99416..99934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3189"
FT                   /product="flavin reductase domain protein FMN-binding"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: psp:PSPPH_2161 flavin reductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3189"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72351"
FT                   /db_xref="GOA:B2JRM4"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRM4"
FT                   /protein_id="ACC72351.1"
FT                   /translation="MEAIQNEACVVDFAKAMRRLASTVCVVATHDDVQPYGMVATAVTS
FT                   LSATPASLLVCINKDASSHPVIERVGRFSVTLLRKDQRHISDRFGSRYSQAERFASSQW
FT                   KMSMRWTLPCLENAQATFFCSLARQFEHGTHTVFVGDVLQTVVNDEVDPLLYADGAYRC
FT                   LDSVQAHLT"
     MEAIQNEACV VDFAKAMRRL ASTVCVVATH DDVQPYGMVA TAVTSLSATP ASLLVCINKD        60
     ASSHPVIERV GRFSVTLLRK DQRHISDRFG SRYSQAERFA SSQWKMSMRW TLPCLENAQA       120
     TFFCSLARQF EHGTHTVFVG DVLQTVVNDE VDPLLYADGA YRCLDSVQAH LT               172
//

If you have problems or comments...

PBIL Back to PBIL home page