(data stored in ACNUC29543 zone)

EMBL: CP001044.PE85

CP001044.PE85        Location/Qualifiers
FT   CDS             103536..104627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3194"
FT                   /product="ISRSO5-transposase protein"
FT                   /note="KEGG: rso:RSp1675 ISRSO5-transposase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3194"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72354"
FT                   /db_xref="GOA:B2JPF0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B2JPF0"
FT                   /protein_id="ACC72354.1"
FT                   /translation="MPMGRPKAELELSEDERSQLISIARSRSISAALVTRARIVLAAAD
FT                   GEPNSAIAQRLQLTRATVGKWRLRFLEQRINGLYDEVRPGKPRTIDDERLAQLIHKTLH
FT                   TKPADGSTHWSVRTIAAETAISPTSVHRYFKLLGLQPHRSESFKLSTDQFFIEKLRDVV
FT                   GLYLSPPENALVLCVDEKSQCQALERTQPMLPMGFGYVEGVTHDYVRHGTTTLFAALNV
FT                   LNGAVLATCKPRHRHQEFLSFLREIDKAVPAELDVHCIVDNYSSHKHPKVKAWLAARPR
FT                   WHMHFIPTYSSWLNQVERFFALITDKAIRRGSFGSVKQLIRRIDQFVSHYNENCKPFIW
FT                   TASADSILEKLHRLCSRISGTEH"
     MPMGRPKAEL ELSEDERSQL ISIARSRSIS AALVTRARIV LAAADGEPNS AIAQRLQLTR        60
     ATVGKWRLRF LEQRINGLYD EVRPGKPRTI DDERLAQLIH KTLHTKPADG STHWSVRTIA       120
     AETAISPTSV HRYFKLLGLQ PHRSESFKLS TDQFFIEKLR DVVGLYLSPP ENALVLCVDE       180
     KSQCQALERT QPMLPMGFGY VEGVTHDYVR HGTTTLFAAL NVLNGAVLAT CKPRHRHQEF       240
     LSFLREIDKA VPAELDVHCI VDNYSSHKHP KVKAWLAARP RWHMHFIPTY SSWLNQVERF       300
     FALITDKAIR RGSFGSVKQL IRRIDQFVSH YNENCKPFIW TASADSILEK LHRLCSRISG       360
     TEH                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page