(data stored in ACNUC29543 zone)

EMBL: CP001044.PE86

CP001044.PE86        Location/Qualifiers
FT   CDS             complement(104657..105730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3195"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   rso:RS02364 putative methyl-accepting chemotaxis transducer
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3195"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72355"
FT                   /db_xref="GOA:B2JRM8"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRM8"
FT                   /protein_id="ACC72355.1"
FT                   /translation="MVLLGLWELATVVYRVEPGSHVTRLLSIAMVVLATTGCVFSIYCG
FT                   VHLHSVVCGGLNRMGKRLEDIAATLDLSKRSSSPRMDEFGRAAVAFDALMLRIQEAVSD
FT                   VSLSTDTVSRATRALVSGNLDISARTEEQAASLQETASSMTQLTETVKQNADNARCAKD
FT                   EVAKANRIVERSGKVVHEMVATMEKIYGSSSKISEITGVIEGIAFQTNILALNAAVEAA
FT                   RAGEQGRGFAVVASEVRGLAQRSASAAREIKELIGTSVATISEGSKQADRVSVAMDEMK
FT                   AAIENASQMVDEIASASEQQSQGIEQVNQAVILMEQVTQRNAAVIEQGAIAAQALEEET
FT                   HRLEATVTSFKISQDPG"
     MVLLGLWELA TVVYRVEPGS HVTRLLSIAM VVLATTGCVF SIYCGVHLHS VVCGGLNRMG        60
     KRLEDIAATL DLSKRSSSPR MDEFGRAAVA FDALMLRIQE AVSDVSLSTD TVSRATRALV       120
     SGNLDISART EEQAASLQET ASSMTQLTET VKQNADNARC AKDEVAKANR IVERSGKVVH       180
     EMVATMEKIY GSSSKISEIT GVIEGIAFQT NILALNAAVE AARAGEQGRG FAVVASEVRG       240
     LAQRSASAAR EIKELIGTSV ATISEGSKQA DRVSVAMDEM KAAIENASQM VDEIASASEQ       300
     QSQGIEQVNQ AVILMEQVTQ RNAAVIEQGA IAAQALEEET HRLEATVTSF KISQDPG          357
//

If you have problems or comments...

PBIL Back to PBIL home page