(data stored in ACNUC29543 zone)

EMBL: CP001044.PE87

CP001044.PE87        Location/Qualifiers
FT   CDS             complement(105992..107077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3196"
FT                   /product="outer membrane protein (porin)"
FT                   /note="KEGG: bam:Bamb_1076 outer membrane protein (porin)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3196"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72356"
FT                   /db_xref="GOA:B2JRM9"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRM9"
FT                   /protein_id="ACC72356.1"
FT                   /translation="MKTIRSLSLISVSALVAGSACAQSNVTLYGIVDTGVQYYNNATAS
FT                   GGSVVGMPSLSGKLPSRFGLRGVEDLGGGYKAFFVLENGFAVNNGALGYGGRIFGRAAN
FT                   VGIDSRFGTLTLGRQMNMTLYALTDADVIGPSNHSLAVFDTYLPNARSDNAVGYMGKWH
FT                   GFTIGATYSFGRDAAGPAGPSATNCAGQVPGDFVACRQYTVMLAYASETLGVTASYDVM
FT                   RGGTGASAPLSSSANTDTRTIVDGYAKYGNLKLGAGWIRRNTSSTTHSQSDIFFAGGTY
FT                   LLTPAFAVDAQAVRYILRTRSDATLFVGRVSYFLSKRTSIYSSAGYMINSPTSAVPVSA
FT                   GGTVGIGKNQVGFMVGMQQRF"
     MKTIRSLSLI SVSALVAGSA CAQSNVTLYG IVDTGVQYYN NATASGGSVV GMPSLSGKLP        60
     SRFGLRGVED LGGGYKAFFV LENGFAVNNG ALGYGGRIFG RAANVGIDSR FGTLTLGRQM       120
     NMTLYALTDA DVIGPSNHSL AVFDTYLPNA RSDNAVGYMG KWHGFTIGAT YSFGRDAAGP       180
     AGPSATNCAG QVPGDFVACR QYTVMLAYAS ETLGVTASYD VMRGGTGASA PLSSSANTDT       240
     RTIVDGYAKY GNLKLGAGWI RRNTSSTTHS QSDIFFAGGT YLLTPAFAVD AQAVRYILRT       300
     RSDATLFVGR VSYFLSKRTS IYSSAGYMIN SPTSAVPVSA GGTVGIGKNQ VGFMVGMQQR       360
     F                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page