(data stored in ACNUC29543 zone)

EMBL: CP001044.PE90

CP001044.PE90        Location/Qualifiers
FT   CDS             complement(110411..111595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3199"
FT                   /product="membrane protein involved in aromatic hydrocarbon
FT                   degradation"
FT                   /note="PFAM: membrane protein involved in aromatic
FT                   hydrocarbon degradation; KEGG: bur:Bcep18194_B3106 membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3199"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72359"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRN2"
FT                   /protein_id="ACC72359.1"
FT                   /translation="MSMQFGSQGCARALAAGVVIALYAGKALAVDGIALSGTGVKAAGM
FT                   AGTSIAFPQESSSAADNPAGMGLIGSRTDFGIQVLEPLTDFEYGSPSNTLHTGKVYPVP
FT                   DGGANWQINPRLTFGVSLFGTGVGTSYGRPALTVPGAGVAKSSLQTMIAAPTVTWRLTE
FT                   HNIIGIGLSLAYQRFSANGAIVPADDGTLQPLPSHGTANAFGYGIRVGYIWQPASTFTL
FT                   GASYASRIRMSKLSGYENDLLAAGGGRIDIGAQYGIGVAYKVIPSVTLAADWLHMEFSN
FT                   TIIGSAQGFGWQDQDFFRIGVSWDVNQRWTLRTGFSHGNHPIGPSVVAQNLLAAMPVST
FT                   SVAVGATYRIGERDGVSGIFEYGFPVTVKGEGASLGFNEQTKTEVFGVSYGHKF"
     MSMQFGSQGC ARALAAGVVI ALYAGKALAV DGIALSGTGV KAAGMAGTSI AFPQESSSAA        60
     DNPAGMGLIG SRTDFGIQVL EPLTDFEYGS PSNTLHTGKV YPVPDGGANW QINPRLTFGV       120
     SLFGTGVGTS YGRPALTVPG AGVAKSSLQT MIAAPTVTWR LTEHNIIGIG LSLAYQRFSA       180
     NGAIVPADDG TLQPLPSHGT ANAFGYGIRV GYIWQPASTF TLGASYASRI RMSKLSGYEN       240
     DLLAAGGGRI DIGAQYGIGV AYKVIPSVTL AADWLHMEFS NTIIGSAQGF GWQDQDFFRI       300
     GVSWDVNQRW TLRTGFSHGN HPIGPSVVAQ NLLAAMPVST SVAVGATYRI GERDGVSGIF       360
     EYGFPVTVKG EGASLGFNEQ TKTEVFGVSY GHKF                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page