(data stored in ACNUC7421 zone)

EMBL: CP001053.PE10

CP001053.PE10        Location/Qualifiers
FT   CDS             9760..12342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_3999"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; KEGG:
FT                   bxe:Bxe_B0472 putative forkhead-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_3999"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18385"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE64"
FT                   /protein_id="ACD18385.1"
FT                   /translation="MAAGEAPIAEMRATEDAAFDVVLSPIASAQRPALDAIRIVDNLFA
FT                   IGRSEAPFTDYPAERIARLSRRHARVFTEHGAVYVADLGSKNGTTVNGVAVRQTPARVR
FT                   AGDELCFGGELCYRVSIEPRARIVAAASPSAAPGLLLVPQRDDLGLQPIEVQAFPFLVS
FT                   KADEVFSRYKDRYPHQVNYISRRHAHIFLKGGELYVEDLGSTNGTFVGGKRLDESALPL
FT                   VEGDLVAFGGDHFVYRVSLQKPPEVEPTVTQLFVNPAANEAVDPDKTTFVGAAHSFLDI
FT                   FCVDPGLQREDEVNEAAQAASAHAKRDAPTGTAKAASGTNGANGANGAANAAAAKSRPR
FT                   RWRLVAGELGKAFAIDDRASVRRMATWGGVGVVVLAAIATTLYMRGSSERELKNLLANG
FT                   DYTSAVTAASGYLASHPADTKVKALASEALLKAKLPSWLNALQKAQFDQADALLKEMRS
FT                   LSANNADAASLVNELQWVGDLERFVAARGGMDAPIRMYADEGTINNLLQRWEDDARSHQ
FT                   RALDRIASYVPVFADPYAQALSHLRKLESDDSVYLAAIDRLNGTIRTELARDKPDALPP
FT                   VLDDYTQRYPRLAGIDRVRQDLRQYTDLLNAALSRQLVPLLAMLKTARFSTPPFQAQFQ
FT                   QLAASRLPSPDVIARHDAVTAAWQHGDAQQALAGLQAMPAGPWSDVLAAELAHKKTLLD
FT                   QYAQLQKTRGDKDYDQRLLSFYASLDPATDVWFLQSIQKDVAALHDKALARAQDLLLRA
FT                   QSLWKQYRAGGSIGGTQRLEAGISPGFRSEARLLSDAKTSAQQGMRIYTQLKADHPADF
FT                   DRLLADIEAEANLQRRSLTELRMVLDPGLLKAKLALIGGEQSETRQSP"
     MAAGEAPIAE MRATEDAAFD VVLSPIASAQ RPALDAIRIV DNLFAIGRSE APFTDYPAER        60
     IARLSRRHAR VFTEHGAVYV ADLGSKNGTT VNGVAVRQTP ARVRAGDELC FGGELCYRVS       120
     IEPRARIVAA ASPSAAPGLL LVPQRDDLGL QPIEVQAFPF LVSKADEVFS RYKDRYPHQV       180
     NYISRRHAHI FLKGGELYVE DLGSTNGTFV GGKRLDESAL PLVEGDLVAF GGDHFVYRVS       240
     LQKPPEVEPT VTQLFVNPAA NEAVDPDKTT FVGAAHSFLD IFCVDPGLQR EDEVNEAAQA       300
     ASAHAKRDAP TGTAKAASGT NGANGANGAA NAAAAKSRPR RWRLVAGELG KAFAIDDRAS       360
     VRRMATWGGV GVVVLAAIAT TLYMRGSSER ELKNLLANGD YTSAVTAASG YLASHPADTK       420
     VKALASEALL KAKLPSWLNA LQKAQFDQAD ALLKEMRSLS ANNADAASLV NELQWVGDLE       480
     RFVAARGGMD APIRMYADEG TINNLLQRWE DDARSHQRAL DRIASYVPVF ADPYAQALSH       540
     LRKLESDDSV YLAAIDRLNG TIRTELARDK PDALPPVLDD YTQRYPRLAG IDRVRQDLRQ       600
     YTDLLNAALS RQLVPLLAML KTARFSTPPF QAQFQQLAAS RLPSPDVIAR HDAVTAAWQH       660
     GDAQQALAGL QAMPAGPWSD VLAAELAHKK TLLDQYAQLQ KTRGDKDYDQ RLLSFYASLD       720
     PATDVWFLQS IQKDVAALHD KALARAQDLL LRAQSLWKQY RAGGSIGGTQ RLEAGISPGF       780
     RSEARLLSDA KTSAQQGMRI YTQLKADHPA DFDRLLADIE AEANLQRRSL TELRMVLDPG       840
     LLKAKLALIG GEQSETRQSP                                                   860
//

If you have problems or comments...

PBIL Back to PBIL home page