(data stored in ACNUC7421 zone)

EMBL: CP001053.PE100

CP001053.PE100       Location/Qualifiers
FT   CDS             129604..130962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4091"
FT                   /product="protein of unknown function DUF1446"
FT                   /note="PFAM: protein of unknown function DUF1446; KEGG:
FT                   bcm:Bcenmc03_1346 protein of unknown function DUF1446"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4091"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18475"
FT                   /db_xref="InterPro:IPR010839"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEF4"
FT                   /protein_id="ACD18475.1"
FT                   /translation="MTATQPQRRVRIGAGAGYSGDRIEPAVELAQYGALDYLVFECLAE
FT                   RTIAIAQQARSKDPELGYDPLLETRMKAVLPAALRNGVRIISNMGAANPLAAARKTAEI
FT                   ARSLGLGDVKIAAVTGDDVLDVVRQGDFCFVESGERVADYKDRLVSANAYLGASAIVDA
FT                   LAAGAQIVLTGRVADPSLFVAPLIHEFGWRMDDWQTLGQATVIGHLLECAGQITGGYFA
FT                   DPGFKDVPELARLGFPIAEVGQDGGVVITKLAQAGGRVTEATCKEQLLYEIHDPQRYLQ
FT                   PDVVADFSQVRVAQEAPDRVRVSGGRGTPRTDTLKVSVAYFDGYIGEGQISYGGPGAFA
FT                   RARLALDIVRERLVLTGVQTRELRFDLIGVNALHGETAAVGYAEPYEVRARVAGRTTSL
FT                   AQAVQIGNEVETLYTNGPAGGGGVTKSAREVVAVQSVLLPREHVTPAFSMVEA"
     MTATQPQRRV RIGAGAGYSG DRIEPAVELA QYGALDYLVF ECLAERTIAI AQQARSKDPE        60
     LGYDPLLETR MKAVLPAALR NGVRIISNMG AANPLAAARK TAEIARSLGL GDVKIAAVTG       120
     DDVLDVVRQG DFCFVESGER VADYKDRLVS ANAYLGASAI VDALAAGAQI VLTGRVADPS       180
     LFVAPLIHEF GWRMDDWQTL GQATVIGHLL ECAGQITGGY FADPGFKDVP ELARLGFPIA       240
     EVGQDGGVVI TKLAQAGGRV TEATCKEQLL YEIHDPQRYL QPDVVADFSQ VRVAQEAPDR       300
     VRVSGGRGTP RTDTLKVSVA YFDGYIGEGQ ISYGGPGAFA RARLALDIVR ERLVLTGVQT       360
     RELRFDLIGV NALHGETAAV GYAEPYEVRA RVAGRTTSLA QAVQIGNEVE TLYTNGPAGG       420
     GGVTKSAREV VAVQSVLLPR EHVTPAFSMV EA                                     452
//

If you have problems or comments...

PBIL Back to PBIL home page