(data stored in ACNUC7421 zone)

EMBL: CP001053.PE101

CP001053.PE101       Location/Qualifiers
FT   CDS             130964..131278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4092"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmu:Bmul_1927 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4092"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18476"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEF5"
FT                   /protein_id="ACD18476.1"
FT                   /translation="MKLRELAHSRTGDKGNTLNISVICYDAQHYDHLRTVLTPERVKAH
FT                   LRDVVRGDVVRHELPAIAAFNFVLGNALGGGVTRSLALDAHGKSLSSALMDLDVEAPAS
FT                   "
     MKLRELAHSR TGDKGNTLNI SVICYDAQHY DHLRTVLTPE RVKAHLRDVV RGDVVRHELP        60
     AIAAFNFVLG NALGGGVTRS LALDAHGKSL SSALMDLDVE APAS                        104
//

If you have problems or comments...

PBIL Back to PBIL home page