(data stored in ACNUC7421 zone)

EMBL: CP001053.PE105

CP001053.PE105       Location/Qualifiers
FT   CDS             complement(135141..136067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4096"
FT                   /product="transcriptional regulator, LysR family"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: spe:Spro_3137 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4096"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18480"
FT                   /db_xref="GOA:B2TEF9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEF9"
FT                   /protein_id="ACD18480.1"
FT                   /translation="MDRFGSLNVFVRAAETRSFTEAGRQLGISSSAVGKAISRLEGRLG
FT                   VRLFHRSTRSIALTPEGATFLTRCQRIIGEIEAAENELALANAAPRGLLRVSMPMVSTL
FT                   MMPVIAAFMKTYPDIVLDIDFSDRMVDVIEEGFDVVTRTGDAIDSTLVTRTMGTYRHVI
FT                   VGSPAYFAQRGVPSEPEQLREHACLQHRFPTTNKLRRWPLMRDGELLNIDLPTTAIATA
FT                   VEPLTMLAEQDLGLACVPDFTIRAQLARGSLVAVLQTYTDTPTVFRALWPSGRQISPKA
FT                   RVFVDYLSEHLFPVSAAAAGARGAGRA"
     MDRFGSLNVF VRAAETRSFT EAGRQLGISS SAVGKAISRL EGRLGVRLFH RSTRSIALTP        60
     EGATFLTRCQ RIIGEIEAAE NELALANAAP RGLLRVSMPM VSTLMMPVIA AFMKTYPDIV       120
     LDIDFSDRMV DVIEEGFDVV TRTGDAIDST LVTRTMGTYR HVIVGSPAYF AQRGVPSEPE       180
     QLREHACLQH RFPTTNKLRR WPLMRDGELL NIDLPTTAIA TAVEPLTMLA EQDLGLACVP       240
     DFTIRAQLAR GSLVAVLQTY TDTPTVFRAL WPSGRQISPK ARVFVDYLSE HLFPVSAAAA       300
     GARGAGRA                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page