(data stored in ACNUC7421 zone)

EMBL: CP001053.PE107

CP001053.PE107       Location/Qualifiers
FT   CDS             complement(136840..137961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4098"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   sco:SCP1.239c putative oxidoreductase, mmyg"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4098"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18482"
FT                   /db_xref="GOA:B2TEG1"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEG1"
FT                   /protein_id="ACD18482.1"
FT                   /translation="MTEKSAVSKVTPIRVGIVGVGNWAQHGHVRVLSLLPQYELTAVFS
FT                   QRREAAQGVAERYGFKYVVDSLDELVTHPEVDLVIVLTTAPQHAEGVRAAIAAGKDVYC
FT                   EWPLTPSVATSQELIDLAREANVRHVVGLQRRLAPHNRYVRDLLAQGYVGKLRSVRIHV
FT                   SMNYFQALRSQSLRWTVPSENFSSVIAIYAGHFLDMLFEATGWPHAIAALSVNQFEQVT
FT                   IAETGEAMPTTTPDQLVLAGRLQDGAVLSVHIEGGKRNGSGVQIDITGTEGDLRITNRS
FT                   AFGNVGDDYVIEGAHGNNLPLATLPVPASYDQLPPSDLPSAVLELAQLYAAFADDVRTG
FT                   GHTAPTFEHAVRLHKLLDAAVESSDSGRHIELD"
     MTEKSAVSKV TPIRVGIVGV GNWAQHGHVR VLSLLPQYEL TAVFSQRREA AQGVAERYGF        60
     KYVVDSLDEL VTHPEVDLVI VLTTAPQHAE GVRAAIAAGK DVYCEWPLTP SVATSQELID       120
     LAREANVRHV VGLQRRLAPH NRYVRDLLAQ GYVGKLRSVR IHVSMNYFQA LRSQSLRWTV       180
     PSENFSSVIA IYAGHFLDML FEATGWPHAI AALSVNQFEQ VTIAETGEAM PTTTPDQLVL       240
     AGRLQDGAVL SVHIEGGKRN GSGVQIDITG TEGDLRITNR SAFGNVGDDY VIEGAHGNNL       300
     PLATLPVPAS YDQLPPSDLP SAVLELAQLY AAFADDVRTG GHTAPTFEHA VRLHKLLDAA       360
     VESSDSGRHI ELD                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page