(data stored in ACNUC7421 zone)

EMBL: CP001053.PE108

CP001053.PE108       Location/Qualifiers
FT   CDS             complement(138042..138788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4099"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: bvi:Bcep1808_3959 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4099"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18483"
FT                   /db_xref="GOA:B2TEG2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEG2"
FT                   /protein_id="ACD18483.1"
FT                   /translation="MKLTGNTIFITGGGSGIGRGLAEAFHKLGNQVIIAGRRKANLEET
FT                   IAANPGIQSVELDITDPQSITAVSQQLIAQYPSLNVLINNAGVMQIDDLSKPVNDALIV
FT                   STLTTNLMGPIRLTGALVEHLKQQGDATIINVSSVLGFVPMAISGVYSSAKAAIHSYTQ
FT                   SLRYKLKDTSVRVVEIAPPWVQTDLLDSRNEPRAMPLAPFIEQTMHELGTDADEAIVEI
FT                   ARPLRNNPGPNEAAFVTQFNDMFAGA"
     MKLTGNTIFI TGGGSGIGRG LAEAFHKLGN QVIIAGRRKA NLEETIAANP GIQSVELDIT        60
     DPQSITAVSQ QLIAQYPSLN VLINNAGVMQ IDDLSKPVND ALIVSTLTTN LMGPIRLTGA       120
     LVEHLKQQGD ATIINVSSVL GFVPMAISGV YSSAKAAIHS YTQSLRYKLK DTSVRVVEIA       180
     PPWVQTDLLD SRNEPRAMPL APFIEQTMHE LGTDADEAIV EIARPLRNNP GPNEAAFVTQ       240
     FNDMFAGA                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page