(data stored in ACNUC7421 zone)

EMBL: CP001053.PE109

CP001053.PE109       Location/Qualifiers
FT   CDS             complement(139047..139757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4100"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: psb:Psyr_4228 regulatory protein,
FT                   GntR:bacterial regulatory protein, GntR"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4100"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18484"
FT                   /db_xref="GOA:B2TEG3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEG3"
FT                   /protein_id="ACD18484.1"
FT                   /translation="MSSLTEKVVATLSDEIRRGTLRPGDRIPTEVAMMKQLSVSRSVVR
FT                   EAISRLQAAKVVETRHGIGTFVLEPATEKSMQLPAADLSSMLDVMAIIEFRIDVEAASA
FT                   ALAAARRTDQNLKQIRGALERFESELERGSTDTLAHDIEFHLQIARASGNRYFFDVLSQ
FT                   LGRAVSPRTRLGSAEIAELDHIEHLRNVLSEHQMIYRAIERQDPDDARAAMRMHLSNSR
FT                   ERLRRAHELSKAGD"
     MSSLTEKVVA TLSDEIRRGT LRPGDRIPTE VAMMKQLSVS RSVVREAISR LQAAKVVETR        60
     HGIGTFVLEP ATEKSMQLPA ADLSSMLDVM AIIEFRIDVE AASAALAAAR RTDQNLKQIR       120
     GALERFESEL ERGSTDTLAH DIEFHLQIAR ASGNRYFFDV LSQLGRAVSP RTRLGSAEIA       180
     ELDHIEHLRN VLSEHQMIYR AIERQDPDDA RAAMRMHLSN SRERLRRAHE LSKAGD           236
//

If you have problems or comments...

PBIL Back to PBIL home page