(data stored in ACNUC7421 zone)

EMBL: CP001053.PE116

CP001053.PE116       Location/Qualifiers
FT   CDS             complement(147155..148531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4107"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: rha:RHA1_ro08874
FT                   probable metabolite transporter, MFS superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4107"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18491"
FT                   /db_xref="GOA:B2TEH0"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEH0"
FT                   /protein_id="ACD18491.1"
FT                   /translation="MIQDTQQGTHAAMRTRAVTAAAVGTALEWFDFTLYGALAATVLPK
FT                   LFFPSMDSTSALLASLATFGVGLAARPLGAIICGHLGDKLGRRNLMLGTVTVMGLASML
FT                   MGLLPTYASIGVWAPVLLVLLRILQGFALGGESTGAQLMAIEHASADRRGKYSGLLGLC
FT                   SPLSQIMANGVLLLLSSMMSAQAFDSYGWRIPFILSFILVVVGVYIRLRVSETPAFVAL
FT                   RKTEVVHVGSPLRDALRLHWRTVLRWMLFFCGPAAIFYLIVVFSLSYITKTLAIPKQTG
FT                   FLLLMGANVCAIVGALAGGMLSDKIGRKKALAIGSIATLLMLFVYFQILDTKSFVPMLA
FT                   AMGFFLGFTQFQSGIQPVAFAEAFPTNVRYSGSALAYTGANLVAGGPMPVLAVWLFSVC
FT                   NGSPWGVVAVCVVFNVISLVMILTARETLGIDMNRTDSTAAVTGEADFTPAHVSNSHRT
FT                   "
     MIQDTQQGTH AAMRTRAVTA AAVGTALEWF DFTLYGALAA TVLPKLFFPS MDSTSALLAS        60
     LATFGVGLAA RPLGAIICGH LGDKLGRRNL MLGTVTVMGL ASMLMGLLPT YASIGVWAPV       120
     LLVLLRILQG FALGGESTGA QLMAIEHASA DRRGKYSGLL GLCSPLSQIM ANGVLLLLSS       180
     MMSAQAFDSY GWRIPFILSF ILVVVGVYIR LRVSETPAFV ALRKTEVVHV GSPLRDALRL       240
     HWRTVLRWML FFCGPAAIFY LIVVFSLSYI TKTLAIPKQT GFLLLMGANV CAIVGALAGG       300
     MLSDKIGRKK ALAIGSIATL LMLFVYFQIL DTKSFVPMLA AMGFFLGFTQ FQSGIQPVAF       360
     AEAFPTNVRY SGSALAYTGA NLVAGGPMPV LAVWLFSVCN GSPWGVVAVC VVFNVISLVM       420
     ILTARETLGI DMNRTDSTAA VTGEADFTPA HVSNSHRT                               458
//

If you have problems or comments...

PBIL Back to PBIL home page