(data stored in ACNUC7421 zone)

EMBL: CP001053.PE119

CP001053.PE119       Location/Qualifiers
FT   CDS             complement(150684..151547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4110"
FT                   /product="Hydroxyquinol 1,2-dioxygenase"
FT                   /EC_number="1.13.11.37"
FT                   /note="PFAM: intradiol ring-cleavage dioxygenase; Catechol
FT                   dioxygenase domain protein; KEGG: bam:Bamb_3333 catechol
FT                   1,2-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4110"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18494"
FT                   /db_xref="GOA:B2TEH3"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR007535"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="InterPro:IPR039390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEH3"
FT                   /protein_id="ACD18494.1"
FT                   /translation="MRNLDENTITEAVLARHAHSGDERLKTIVTSLVRHLHDFAREVNL
FT                   TESEWEQGIRFLTDVGLITDDKRQEFILLSDTLGLSMLVTAMANRKPPGCTEATVFGPF
FT                   FVEGAPAYRNGDDVSNGARGEPCFVSGTVKGADGEAVANARIEVWQADADGFYDVQHAG
FT                   DDTHRARGVLHSLADGRYHFRSIVAEPYPIPHDGPVGRMLAALGRHPWRPAHLHFMITA
FT                   PGYERLVTHVFREGDQYLDSDAVFGVRSSLVAQWKHHEAGTAPDGTSMTTPFSTLEFDF
FT                   VLNRSV"
     MRNLDENTIT EAVLARHAHS GDERLKTIVT SLVRHLHDFA REVNLTESEW EQGIRFLTDV        60
     GLITDDKRQE FILLSDTLGL SMLVTAMANR KPPGCTEATV FGPFFVEGAP AYRNGDDVSN       120
     GARGEPCFVS GTVKGADGEA VANARIEVWQ ADADGFYDVQ HAGDDTHRAR GVLHSLADGR       180
     YHFRSIVAEP YPIPHDGPVG RMLAALGRHP WRPAHLHFMI TAPGYERLVT HVFREGDQYL       240
     DSDAVFGVRS SLVAQWKHHE AGTAPDGTSM TTPFSTLEFD FVLNRSV                     287
//

If you have problems or comments...

PBIL Back to PBIL home page