(data stored in ACNUC7421 zone)

EMBL: CP001053.PE121

CP001053.PE121       Location/Qualifiers
FT   CDS             complement(152561..153442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4112"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; TrkA-N domain
FT                   protein; NmrA family protein; Male sterility domain; KEGG:
FT                   mrd:Mrad2831_0235 NmrA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4112"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18496"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEH5"
FT                   /protein_id="ACD18496.1"
FT                   /translation="MAILVTGSTGVVGKQVLEHLLAAGGAQVRALTRSPEKAQFPDGVT
FT                   AVQGDLSDVDGLRRAMNGVSTLFLLAPNAPDELTQALQTLSVAREAGVKGVVYLSVFKG
FT                   AEYVDVPHFTGKHTVERMIEHCDLPATVLRPAYFIQNDVRQKEPLLTHGVYGMPIGAKG
FT                   ISMVDVRDIGEAAARELLRRERSATRLPRETYELVGPDAITSETVASIWAEALGRSVRY
FT                   GGDDLDVLEQRLKAAAPGWLVYDMRLMMSRYQQDGAVASQAQIDHLATLLGRQPRSYRE
FT                   FAAEMAAAWKNG"
     MAILVTGSTG VVGKQVLEHL LAAGGAQVRA LTRSPEKAQF PDGVTAVQGD LSDVDGLRRA        60
     MNGVSTLFLL APNAPDELTQ ALQTLSVARE AGVKGVVYLS VFKGAEYVDV PHFTGKHTVE       120
     RMIEHCDLPA TVLRPAYFIQ NDVRQKEPLL THGVYGMPIG AKGISMVDVR DIGEAAAREL       180
     LRRERSATRL PRETYELVGP DAITSETVAS IWAEALGRSV RYGGDDLDVL EQRLKAAAPG       240
     WLVYDMRLMM SRYQQDGAVA SQAQIDHLAT LLGRQPRSYR EFAAEMAAAW KNG              293
//

If you have problems or comments...

PBIL Back to PBIL home page