(data stored in ACNUC7421 zone)

EMBL: CP001053.PE123

CP001053.PE123       Location/Qualifiers
FT   CDS             complement(154499..155131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4114"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0542 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4114"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18498"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEH7"
FT                   /protein_id="ACD18498.1"
FT                   /translation="MKRSAAEIITEYGPFEGMERVHGVTYDGQHVWFATGNALNAFDPE
FT                   SGKQVRSIDVAAHAGTAFDGEHLFQIAEDRIQKIDPKTGRVLATIPAPGGGADSGLAWA
FT                   EGTLWVGQYRERKIHQVDPQTGAILRTIESNRFVTGVTWVDGELWHGTWEGDESELRRI
FT                   DPRTGEVQERLEMPAGVSVSGLESNGGDRFYCGGGSSGKVRAVRRPK"
     MKRSAAEIIT EYGPFEGMER VHGVTYDGQH VWFATGNALN AFDPESGKQV RSIDVAAHAG        60
     TAFDGEHLFQ IAEDRIQKID PKTGRVLATI PAPGGGADSG LAWAEGTLWV GQYRERKIHQ       120
     VDPQTGAILR TIESNRFVTG VTWVDGELWH GTWEGDESEL RRIDPRTGEV QERLEMPAGV       180
     SVSGLESNGG DRFYCGGGSS GKVRAVRRPK                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page