(data stored in ACNUC7421 zone)

EMBL: CP001053.PE126

CP001053.PE126       Location/Qualifiers
FT   CDS             157460..159097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4117"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; Cache type 2
FT                   domain protein; KEGG: bpd:BURPS668_A2780 methyl-accepting
FT                   chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4117"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18501"
FT                   /db_xref="GOA:B2TEI0"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEI0"
FT                   /protein_id="ACD18501.1"
FT                   /translation="MVRFSFTQKLWLPLVVSLVALLAVSVSAAWLSRQTRIEERKNDLV
FT                   NVAHVGLSIVTEYAALAQSGALSEADARRQALERLRGIRYGEDGYFLVIDSTPRMVMHA
FT                   MKPALNGKDLAGTADADGRHHYVTFAAVAQKPNGGFVDYVFPHPQDPPSAAVGKIGYVV
FT                   RYAPWDWIIATGAYVDDIDAAFKESLYFVGGIFAVLALLLSALVSLTNRSIRRTIGGDP
FT                   VYVAQVAGEITRGNLAIPINLRHGDESSLLHTVYLMRDALAHTIEQIKGAADKVATGAR
FT                   EIAGGNTDLSARTENQAASLEETAASMEQMTAMVRQTAENAQTASQLTAGAEQIVNRGG
FT                   EMAAQAVSTMQEISTESHKMVEIISVIEGIAFQTNILALNAAVEAARAGDAGRGFAVVA
FT                   GEVRTLAQRSAAAAKEIRALISHAVDKVGTGAEFVGQTGATIHSAREAIAKVSGVMRDI
FT                   AAAAAEQSAGIDQVGDAVAQMDSVTQQNAALVEQAAAVAQTLTEQARLLQVSISQFNLQ
FT                   QHGADEAAGLLRVRRPAAEEARGFAAVV"
     MVRFSFTQKL WLPLVVSLVA LLAVSVSAAW LSRQTRIEER KNDLVNVAHV GLSIVTEYAA        60
     LAQSGALSEA DARRQALERL RGIRYGEDGY FLVIDSTPRM VMHAMKPALN GKDLAGTADA       120
     DGRHHYVTFA AVAQKPNGGF VDYVFPHPQD PPSAAVGKIG YVVRYAPWDW IIATGAYVDD       180
     IDAAFKESLY FVGGIFAVLA LLLSALVSLT NRSIRRTIGG DPVYVAQVAG EITRGNLAIP       240
     INLRHGDESS LLHTVYLMRD ALAHTIEQIK GAADKVATGA REIAGGNTDL SARTENQAAS       300
     LEETAASMEQ MTAMVRQTAE NAQTASQLTA GAEQIVNRGG EMAAQAVSTM QEISTESHKM       360
     VEIISVIEGI AFQTNILALN AAVEAARAGD AGRGFAVVAG EVRTLAQRSA AAAKEIRALI       420
     SHAVDKVGTG AEFVGQTGAT IHSAREAIAK VSGVMRDIAA AAAEQSAGID QVGDAVAQMD       480
     SVTQQNAALV EQAAAVAQTL TEQARLLQVS ISQFNLQQHG ADEAAGLLRV RRPAAEEARG       540
     FAAVV                                                                   545
//

If you have problems or comments...

PBIL Back to PBIL home page