(data stored in ACNUC7421 zone)

EMBL: CP001053.PE136

CP001053.PE136       Location/Qualifiers
FT   CDS             169451..170692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4127"
FT                   /product="amidase, hydantoinase/carbamoylase family"
FT                   /EC_number="3.5.1.87"
FT                   /note="KEGG: bxe:Bxe_B0554 allantoate amidohydrolase;
FT                   TIGRFAM: amidase, hydantoinase/carbamoylase family; PFAM:
FT                   peptidase M20; peptidase dimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4127"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18511"
FT                   /db_xref="GOA:B2TEJ0"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEJ0"
FT                   /protein_id="ACD18511.1"
FT                   /translation="MVRIDPDRLLSDLKQLRSFGATGPGVVRLALSPVDLASREWLAGR
FT                   MTEAGLEAAIDGVGTVFGRSRKSGPALVIGSHTDTQPTGGWLDGAMGVIYGLEIARALA
FT                   ENEATRHLAVDVASWIDEEGTFSGLLGSRSFVGENVDETIRDATNRQGQRLADVLATAG
FT                   LAGRPRARFEPGRQVAYLEPHIEQGGRLEAAGKSIGVVTTIVGLRELRLRFTGQRNHAG
FT                   TTPMAIRRDAGAALVAFIPQMNEAFAQLADADTVWTVGRIDLDPGSLSVVPGAAQMYLQ
FT                   FRDANAARLQAMEDRLAQLVRDFNARSSISVELTTIDEPMQPVTMHTVLADHLARAAEA
FT                   VAPGQWIRMPSGAAHDAQVIARCMPACMMFVPSIGGVSHDFIEDTAEAHIVLGCQVAAT
FT                   AAAAMLEEQWAKRS"
     MVRIDPDRLL SDLKQLRSFG ATGPGVVRLA LSPVDLASRE WLAGRMTEAG LEAAIDGVGT        60
     VFGRSRKSGP ALVIGSHTDT QPTGGWLDGA MGVIYGLEIA RALAENEATR HLAVDVASWI       120
     DEEGTFSGLL GSRSFVGENV DETIRDATNR QGQRLADVLA TAGLAGRPRA RFEPGRQVAY       180
     LEPHIEQGGR LEAAGKSIGV VTTIVGLREL RLRFTGQRNH AGTTPMAIRR DAGAALVAFI       240
     PQMNEAFAQL ADADTVWTVG RIDLDPGSLS VVPGAAQMYL QFRDANAARL QAMEDRLAQL       300
     VRDFNARSSI SVELTTIDEP MQPVTMHTVL ADHLARAAEA VAPGQWIRMP SGAAHDAQVI       360
     ARCMPACMMF VPSIGGVSHD FIEDTAEAHI VLGCQVAATA AAAMLEEQWA KRS              413
//

If you have problems or comments...

PBIL Back to PBIL home page