(data stored in ACNUC7421 zone)

EMBL: CP001053.PE138

CP001053.PE138       Location/Qualifiers
FT   CDS             complement(171643..171948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4129"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0555 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4129"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18513"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEJ2"
FT                   /protein_id="ACD18513.1"
FT                   /translation="MRMLLNIRIPHEPFNTMVREGTVGQVIGKILEEIKPEAVYFTEQS
FT                   GARGAVVVVDIDNASAIPALAEPWFLKFNADCELRIAMLPEDLQKAGLENLGSKWK"
     MRMLLNIRIP HEPFNTMVRE GTVGQVIGKI LEEIKPEAVY FTEQSGARGA VVVVDIDNAS        60
     AIPALAEPWF LKFNADCELR IAMLPEDLQK AGLENLGSKW K                           101
//

If you have problems or comments...

PBIL Back to PBIL home page