(data stored in ACNUC7421 zone)

EMBL: CP001053.PE139

CP001053.PE139       Location/Qualifiers
FT   CDS             complement(172109..172741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4130"
FT                   /product="methylated-DNA/protein-cysteine
FT                   methyltransferase"
FT                   /note="TIGRFAM: methylated-DNA/protein-cysteine
FT                   methyltransferase; PFAM: methylguanine DNA
FT                   methyltransferase ribonuclease domain protein;
FT                   Methylated-DNA-[protein]-cysteine S-methyltransferase DNA
FT                   binding; KEGG: bxe:Bxe_B0556
FT                   methylated-DNA-(protein)-cysteine S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4130"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18514"
FT                   /db_xref="GOA:B2TEJ3"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEJ3"
FT                   /protein_id="ACD18514.1"
FT                   /translation="MTYAYKLMDSPVGQLKLVANGERLAAILWEHDKPNRVRLGELIEA
FT                   NDRPVLIETERQLNEYFAGTRHEFDLPLTFQGTDFQKQVWAALLTIPFGQTRSYSEIAT
FT                   QIGNVNAVRAVGAANGKNPISIVAPCHRVIGASGDLTGFAGGLANKMLLLSLEAGQTSF
FT                   EAEADGQTDMFALEQRATVKTQVKSEAQTKPARHAPSRGTQASLFGN"
     MTYAYKLMDS PVGQLKLVAN GERLAAILWE HDKPNRVRLG ELIEANDRPV LIETERQLNE        60
     YFAGTRHEFD LPLTFQGTDF QKQVWAALLT IPFGQTRSYS EIATQIGNVN AVRAVGAANG       120
     KNPISIVAPC HRVIGASGDL TGFAGGLANK MLLLSLEAGQ TSFEAEADGQ TDMFALEQRA       180
     TVKTQVKSEA QTKPARHAPS RGTQASLFGN                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page