(data stored in ACNUC7421 zone)

EMBL: CP001053.PE140

CP001053.PE140       Location/Qualifiers
FT   CDS             173034..174371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4131"
FT                   /product="serine/threonine protein kinase"
FT                   /note="SMART: tyrosine protein kinase; serine/threonine
FT                   protein kinase; leucine-rich repeat-containing protein
FT                   typical subtype; Protein kinase ATP binding, conserved
FT                   site; KEGG: bxe:Bxe_B0557 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4131"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18515"
FT                   /db_xref="GOA:B2TEJ4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEJ4"
FT                   /protein_id="ACD18515.1"
FT                   /translation="MTTTLDHLRAGQLAGTRRLKLACGLTEFPREIFDLADTLEVLDLS
FT                   GNALTSLPDDLPRLRKLRILFGSDNPFTELPEVLGQCSQLSMVGFKANRIRHVSGKALP
FT                   PQLRWLILTDNEIEVLPAEIGRCSQLQKLMLAGNRLRTLPEELAACSQLELLRLAANQL
FT                   DGLPDWLLRLPRLSWLAYAGNPFSEALEAAALTDTPSVAIAWHDLKLDAPLGEGASGVI
FT                   YRAELAGRHGASRSVAVKLFKGAVTSDGLPDCEMAACIRAGDHTNLIPVAGKVKDHPAG
FT                   THGLVMELIDPQFTNLAGPPSLESCTRDIYDADTRFDMASALGIAYGIASAACHLHEQG
FT                   IMHGDLYAHNILYGGEGRALLGDFGAASFYALGDRRIGLALQRLEVSAYGCLLEELLER
FT                   CDWPEASANIRALLVELKDNCLSEAIDSRPLFDEITARLLALMGDR"
     MTTTLDHLRA GQLAGTRRLK LACGLTEFPR EIFDLADTLE VLDLSGNALT SLPDDLPRLR        60
     KLRILFGSDN PFTELPEVLG QCSQLSMVGF KANRIRHVSG KALPPQLRWL ILTDNEIEVL       120
     PAEIGRCSQL QKLMLAGNRL RTLPEELAAC SQLELLRLAA NQLDGLPDWL LRLPRLSWLA       180
     YAGNPFSEAL EAAALTDTPS VAIAWHDLKL DAPLGEGASG VIYRAELAGR HGASRSVAVK       240
     LFKGAVTSDG LPDCEMAACI RAGDHTNLIP VAGKVKDHPA GTHGLVMELI DPQFTNLAGP       300
     PSLESCTRDI YDADTRFDMA SALGIAYGIA SAACHLHEQG IMHGDLYAHN ILYGGEGRAL       360
     LGDFGAASFY ALGDRRIGLA LQRLEVSAYG CLLEELLERC DWPEASANIR ALLVELKDNC       420
     LSEAIDSRPL FDEITARLLA LMGDR                                             445
//

If you have problems or comments...

PBIL Back to PBIL home page