(data stored in ACNUC7421 zone)

EMBL: CP001053.PE141

CP001053.PE141       Location/Qualifiers
FT   CDS             174451..175440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4132"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: bxe:Bxe_B0558 ABC sugar
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4132"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18516"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEJ5"
FT                   /protein_id="ACD18516.1"
FT                   /translation="MMQKTPRSMPSWRMRRRVVIAGALAAAGIGGAADAAATPGGKLKI
FT                   ALVLKSLGDPFTIAMASAAQNYQQHYASQFDLTVRGTATESDTTGQIRMVEEMIKAKMN
FT                   AIVIAPTDSKALTAVVARAIKAGVIVVSIDNPLDEAFQDAAGISVPFVGPNNRKGAQQV
FT                   SNYLAERLKTGDQVGVIEGSSADRNAQQRTDGCRDAMNAAGINIVAVQTGDWEYGKGRD
FT                   AASKMLSEHPQIRGLMCGNDNMAMGAVDAVRDAGRTGGVYVTGYNDIDAIKPLIADGRV
FT                   LATVNQFAARQAVFGVDVALKAVTEQRKQSELSSVIETPLQLVTAANH"
     MMQKTPRSMP SWRMRRRVVI AGALAAAGIG GAADAAATPG GKLKIALVLK SLGDPFTIAM        60
     ASAAQNYQQH YASQFDLTVR GTATESDTTG QIRMVEEMIK AKMNAIVIAP TDSKALTAVV       120
     ARAIKAGVIV VSIDNPLDEA FQDAAGISVP FVGPNNRKGA QQVSNYLAER LKTGDQVGVI       180
     EGSSADRNAQ QRTDGCRDAM NAAGINIVAV QTGDWEYGKG RDAASKMLSE HPQIRGLMCG       240
     NDNMAMGAVD AVRDAGRTGG VYVTGYNDID AIKPLIADGR VLATVNQFAA RQAVFGVDVA       300
     LKAVTEQRKQ SELSSVIETP LQLVTAANH                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page